Velcro Cold Wrap
Home/abstract/Velcro Cold Wrap

Velcro Cold Wrap

Chilly C

0.03 MB size 76 downloads 07/09/2020 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

abstractartclip-artfavgraphicshypermodernillustrationline-artGraphic design

Specs

SVG ID
114460
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Abstract art in pink and yellow

Abstract art in pink and yellow
Prismatic Horse Silhouette Abstract Line Art With Background

Prismatic Horse Silhouette Abstract Line Art With Background
proof of design

proof of design
Abstract visual art

Abstract visual art
Abstract Winged Horse

Abstract Winged Horse
Basic Geometrical Design III 2

Basic Geometrical Design III 2
Eye abstract graphics background

Eye abstract graphics background
Abstract Art 4

Abstract Art 4
Colorful Nova Line Art

Colorful Nova Line Art
Abstract Vortex 80 Polyprismatic

Abstract Vortex 80 Polyprismatic
logo - abstract 2

logo - abstract 2
Abstract Floral Shape Line Art Groovy Edition

Abstract Floral Shape Line Art Groovy Edition
Your experience on this site will be improved by allowing cookies.