Vector image of thin line border with decorative corners
Home/black/Vector image of thin line border with decorative corners

Vector image of thin line border with decorative corners

Vector illustration of thin line border with decorative corners. Drawing of black and white decorative frame with rounded inward corners.

0.02 MB size 748 downloads 19/02/2015 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

blackbordercornerdecorativeflourishframeframesgrayscaletemplatewhiteblack and whitegray scale

Specs

SVG ID
22878
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Border 33

Border 33
Flourishy Frame Line Art 9

Flourishy Frame Line Art 9
Ornamental Frame 2 Derivative 8

Ornamental Frame 2 Derivative 8
Border 22

Border 22
Border 26

Border 26
Border 31

Border 31
Art Noveau style border vector illustration

Art Noveau style border vector illustration
Border 35

Border 35
Vector drawing of gray border with gradient

Vector drawing of gray border with gradient
Border 39

Border 39
Floral Corner Piece

Floral Corner Piece
Border 43

Border 43
Your experience on this site will be improved by allowing cookies.