Please login to access this feature
Teaching emergency preparedness
Home/backpack/Teaching emergency preparedness

Teaching emergency preparedness

Kids are being prepared for giving First Aid in case of emergency.

0.06 MB size 116 downloads 16/08/2018 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

backpackchildrendademergencyfatherflashlightmap Comic characters First responders - emergency worker icons

Specs

SVG ID
76611
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
First responder - HAZMAT military worker

First responder - HAZMAT military worker
First responder - HAZMAT team worker - decontamination

First responder - HAZMAT team worker - decontamination
Citizen monitoring

Citizen monitoring
Crisis management operator

Crisis management operator
Crisis response worker

Crisis response worker
Proud of Dad

Proud of Dad
Family stroll

Family stroll
First responders

First responders
Cartoon father

Cartoon father
Super Dad 2

Super Dad 2
Vector image of father and child

Vector image of father and child
Dad and daughter

Dad and daughter
Your experience on this site will be improved by allowing cookies.