Spring landscape
Home/cartoon/Spring landscape

Spring landscape

Vector image of countryside.

0.00 MB size 119 downloads 27/04/2016 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

cartooncutefarmfieldhillsinkscapelandlandscapelandscapesleavesmeadownaturePlanetsreal estateskysvgreal estate Imagenes en CubilletesHintergrund low poly

Specs

SVG ID
41581
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
High Poly Ocean Sunset

High Poly Ocean Sunset
High Poly Lake Reflection

High Poly Lake Reflection
Small House vector art

Small House vector art
Cartoon Black Ram

Cartoon Black Ram
Moonlight Landscape

Moonlight Landscape
High Poly Green Meadow

High Poly Green Meadow
dune landscape

dune landscape
Low Poly Surreal New Zealand Coast

Low Poly Surreal New Zealand Coast
Low Poly 7th Paradise

Low Poly 7th Paradise
Low Poly Vietnam Valley

Low Poly Vietnam Valley
Stylized Low Detail Landscape

Stylized Low Detail Landscape
Vector clip art of land parcel icon

Vector clip art of land parcel icon
Your experience on this site will be improved by allowing cookies.