Female diver
Home/dive/Female diver

Female diver

Vector image of girl jumping in the water.

0.01 MB size 147 downloads 18/01/2019 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

divedivingfemalegirlladysplashswim intersyllabic v

Specs

SVG ID
80501
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
No Diving

No Diving
Lady in red vector image

Lady in red vector image
Female office lady

Female office lady
Trendy girl driving coupe vector image

Trendy girl driving coupe vector image
Vector illustration of lady playing tennis in a dress

Vector illustration of lady playing tennis in a dress
Lady doctor vector image

Lady doctor vector image
Female in a dance pose

Female in a dance pose
Lady reading

Lady reading
Elegant lady in yellow

Elegant lady in yellow
Elegant lady posing

Elegant lady posing
Blogging girl vector image

Blogging girl vector image
Lady walking icon

Lady walking icon
Your experience on this site will be improved by allowing cookies.