Color wordprocessing file type sign vector drawing
Home/black/Color wordprocessing file type sign vector drawing

Color wordprocessing file type sign vector drawing

Vector image of color wordprocessing file type sign. Color graphics of rectangular desktop icon for a word file.

0.00 MB size 106 downloads 23/01/2015 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

blackbuttonclip artcliparticonkdelinkprimarysimplesvgthemewhite

Specs

SVG ID
21253
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Clear button

Clear button
Vector drawing of monochrome spread sheet file type sign

Vector drawing of monochrome spread sheet file type sign
Monochrome of a web icon

Monochrome of a web icon
Black plus

Black plus
primary button more

primary button more
primary abiword

primary abiword
primary artsbuilderexecute

primary artsbuilderexecute
primary attach

primary attach
primary bookcase

primary bookcase
primary cdrom unmount

primary cdrom unmount
primary chat

primary chat
primary dcgui qt

primary dcgui qt
Your experience on this site will be improved by allowing cookies.